Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-CAMK1D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Rabbit Polyclonal Anti-CAMK1D Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Camk1d antibody is: synthetic peptide directed towards the N-terminal region of Mouse Camk1d. Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY