CAMK1D Rabbit Polyclonal Antibody

CAT#: TA344784

Rabbit Polyclonal Anti-CAMK1D Antibody - middle region

Product Images

WB Suggested Anti-CAMK1D Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: calcium/calmodulin dependent protein kinase ID
• Database Link:
  NP_705718
  Entrez Gene 57118 Human
  UniProt ID Q8IU85
• Background: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
• Synonyms: CaM-K1; CaMKID; CKLiK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase