Antibodies for $/€ 289

Jump to Filters
View as table Download
PRPF4 Rabbit Polyclonal Antibody
TA345893

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRPF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF4 antibody: synthetic peptide directed towards the N terminal of human PRPF4. Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT