PRPF4 Rabbit Polyclonal Antibody

CAT#: TA345893

Rabbit Polyclonal Anti-PRPF4 Antibody

Product Images

WB Suggested Anti-PRPF4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRPF4 antibody: synthetic peptide directed towards the N terminal of human PRPF4. Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: pre-mRNA processing factor 4
• Database Link:
  NP_004688
  Entrez Gene 9128 Human
  UniProt ID O43172
• Background: The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. PRPF4 is 1 of several prote
• Synonyms: HPRP4; HPRP4P; PRP4; Prp4p; RP70; SNRNP60
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Spliceosome