Rabbit Polyclonal Anti-RBM35B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ |
Rabbit Polyclonal Anti-Esrp2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Esrp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT |
Germany
Japan
United Kingdom
China