ESRP2 Rabbit Polyclonal Antibody

CAT#: TA343935

Rabbit Polyclonal Anti-RBM35B Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human epithelial splicing regulatory protein 2 (ESRP2)
    • 20 ug

USD 823.00


Transient overexpression lysate of epithelial splicing regulatory protein 2 (ESRP2)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ESRP2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 77 kDa
Gene Name epithelial splicing regulatory protein 2
Background RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.
Synonyms RBM35B
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.