ESRP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ESRP2 |
ESRP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ESRP2 |
Rabbit Polyclonal Anti-RBM35B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ |
Rabbit Polyclonal Anti-Esrp2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Esrp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT |
Rabbit Polyclonal RBM35B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | RBM35B antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human RBM35B. |
Mouse monoclonal Esrp-2 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Mouse monoclonal Esrp-1/2 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal anti-RBM35B antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of mouse RBM35B. Synthetic peptide located within the following region: EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF |
Esrp2 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Esrp2 |
ESRP2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ESRP2 |