Rabbit Polyclonal Anti-HNRPAB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPAB antibody: synthetic peptide directed towards the C terminal of human HNRPAB. Synthetic peptide located within the following region: QQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY |
Rabbit Polyclonal Anti-HNRPAB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPAB antibody: synthetic peptide directed towards the C terminal of human HNRPAB. Synthetic peptide located within the following region: GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYK |
Rabbit Polyclonal Anti-HNRPAB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPAB antibody: synthetic peptide directed towards the N terminal of human HNRPAB. Synthetic peptide located within the following region: GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK |
Germany
Japan
United Kingdom
China
