Antibodies for $/€ 289

Jump to Filters
View as table Download
NHP2L1 (SNU13) Rabbit Polyclonal Antibody
TA345705

USD 475.00

5 Days

Rabbit Polyclonal Anti-NHP2L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NHP2L1 antibody: synthetic peptide directed towards the N terminal of human NHP2L1. Synthetic peptide located within the following region: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI