NHP2L1 (SNU13) Rabbit Polyclonal Antibody

CAT#: TA345705

Rabbit Polyclonal Anti-NHP2L1 Antibody

Product Images

WB Suggested Anti-NHP2L1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NHP2L1 antibody: synthetic peptide directed towards the N terminal of human NHP2L1. Synthetic peptide located within the following region: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
• Database Link:
  NP_001003796
  Entrez Gene 4809 Human
  UniProt ID P55769
• Background: Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: 15.5K; FA-1; FA1; NHPX; OTK27; SNRNP15-5; SNU13; SPAG12; SSFA1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%

Reference Data

• Protein Pathways: Spliceosome