Antibodies for $/€ 289

Jump to Filters
View as table Download
ZNF16 Rabbit Polyclonal Antibody
TA343647

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF16 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC