ZNF16 Rabbit Polyclonal Antibody

CAT#: TA343647

Rabbit Polyclonal Anti-ZNF16 Antibody

Product Images

WB Suggested Anti-ZNF16 Antibody Titration: 0.03 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: zinc finger protein 16
• Database Link:
  NP_008889
  Entrez Gene 7564 Human
  UniProt ID P17020
• Background: ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified.
• Synonyms: HZF1; KOX9
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 80%

Reference Data

• Protein Families: Transcription Factors