Antibodies for $/€ 289

Jump to Filters
View as table Download
DCUN1D1 Rabbit Polyclonal Antibody
TA344174

USD 475.00

5 Days

Rabbit Polyclonal Anti-DCUN1D1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1. Synthetic peptide located within the following region: SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK