Antibodies for $/€ 289

Jump to Filters
View as table Download
HSD17B6 Rabbit Polyclonal Antibody
TA346101

USD 410.00

5 Days

Rabbit Polyclonal Anti-HSD17B6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B6 antibody: synthetic peptide directed towards the N terminal of human HSD17B6. Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD