HSD17B6 Rabbit Polyclonal Antibody

CAT#: TA346101

Rabbit Polyclonal Anti-HSD17B6 Antibody

Product Images

WB Suggested Anti-HSD17B6 Antibody Titration: 1.25 ug/ml; Positive Control: A172 cell lysateHSD17B6 is strongly supported by BioGPS gene expression data to be expressed in Human A172 cells

• 

  Rabbit Anti-HSD17B6 Antibody; Paraffin Embedded Tissue: Human Liver; Cellular Data: Hemopoietic; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSD17B6 antibody: synthetic peptide directed towards the N terminal of human HSD17B6. Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: hydroxysteroid (17-beta) dehydrogenase 6
• Database Link:
  NP_003716
  Entrez Gene 8630 Human
  UniProt ID O14756
• Background: HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.
• Synonyms: HSE; RODH; SDR9C6
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome