HSD17B6 (NM_003725) Human Recombinant Protein

CAT#: TP304701

Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) (HSD17B6)

Product Images

Coomassie blue staining of purified HSD17B6 protein (Cat# TP304701). The protein was produced from HEK293T cells transfected with HSD17B6 cDNA clone (Cat# RC204701) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204701 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR
  GQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG
  VIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFR
  TGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR
  YSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003716
• Locus ID: 8630
• UniProt ID: O14756, A0A024RB43
• Cytogenetics: 12q13.3
• Refseq Size: 1629
• Refseq ORF: 951
• Synonyms: HSE; RODH; SDR9C6
• Summary: The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome