HSD17B6 (NM_003725) Human Mass Spec Standard

CAT#: PH304701

HSD17B6 MS Standard C13 and N15-labeled recombinant protein (NP_003716)

Product Images

Coomassie blue staining of purified HSD17B6 protein (Cat# TP304701). The protein was produced from HEK293T cells transfected with HSD17B6 cDNA clone (Cat# RC204701) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204701
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC204701 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR
  GQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG
  VIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFR
  TGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR
  YSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003716
• RefSeq Size: 1629
• RefSeq ORF: 951
• Synonyms: HSE; RODH; SDR9C6
• Locus ID: 8630
• UniProt ID: O14756, A0A024RB43
• Cytogenetics: 12q13.3
• Summary: The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome