Antibodies for $/€ 289

Jump to Filters
View as table Download
RABL4 (IFT27) Rabbit Polyclonal Antibody
TA346611

USD 475.00

5 Days

Rabbit Polyclonal Anti-RABL4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4. Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA