RABL4 (IFT27) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human RAB, member of RAS oncogene family-like 4 (RABL4)
USD 823.00
Transient overexpression lysate of RAB, member of RAS oncogene family-like 4 (RABL4)
USD 396.00
Other products for "IFT27"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4. Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 20 kDa |
Gene Name | intraflagellar transport 27 |
Database Link | |
Background | This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Synonyms | BBS19; RABL4; RAYL |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 86%; Bovine: 86%; Pig: 85%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.