RABL4 (IFT27) Rabbit Polyclonal Antibody

CAT#: TA346611

Rabbit Polyclonal Anti-RABL4 Antibody

Product Images

WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.IFT27 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Rabbit Anti-RABL4 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes surrounding the portal vein only, signal is strong but tissue abundance is low; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4. Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: intraflagellar transport 27
• Database Link:
  NP_006851
  Entrez Gene 11020 Human
  UniProt ID Q9BW83
• Background: This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• Synonyms: BBS19; RABL4; RAYL
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 86%; Bovine: 86%; Pig: 85%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome