Antibodies

Jump to Filters
View as table Download
RABL4 (IFT27) Rabbit Polyclonal Antibody
TA346611

USD 475.00

5 Days

Rabbit Polyclonal Anti-RABL4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4. Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
IFT27 Rabbit Polyclonal Antibody
TA366144

USD 380.00

4 Weeks

IFT27 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IFT27
IFT27 Rabbit Polyclonal Antibody
TA370497

USD 380.00

4 Weeks

IFT27 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IFT27