Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK