NIPP1 (PPP1R8) Rabbit Polyclonal Antibody

CAT#: TA345806

Rabbit Polyclonal Anti-PPP1R8 Antibody

Product Images

WB Suggested Anti-PPP1R8 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Thymus

• 

  Rabbit Anti-PPP1R8 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: protein phosphatase 1 regulatory subunit 8
• Database Link:
  NP_002704
  Entrez Gene 5511 Human
  UniProt ID Q12972
• Background: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
• Synonyms: ARD-1; ARD1; NIPP-1; NIPP1; PRO2047
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors