Antibodies for $/€ 289

Jump to Filters
View as table Download
PRPS2 Rabbit Polyclonal Antibody
TA346065

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRPS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
PNPT1 Rabbit Polyclonal Antibody
TA343959

USD 475.00

5 Days

Rabbit Polyclonal Anti-PNPT1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED