PRPS2 Rabbit Polyclonal Antibody

CAT#: TA346065

Rabbit Polyclonal Anti-PRPS2 Antibody

Product Images

WB Suggested Anti-PRPS2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-PRPS2 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: phosphoribosyl pyrophosphate synthetase 2
• Database Link:
  NP_002756
  Entrez Gene 5634 Human
  UniProt ID P11908
• Background: The function remains unknown.
• Synonyms: PRSII
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pentose phosphate pathway, Purine metabolism