Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC |
Rabbit Polyclonal Anti-BSDC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Germany
Japan
United Kingdom
China
