Apc7 (ANAPC7) Rabbit Polyclonal Antibody

CAT#: TA346133

Rabbit Polyclonal Anti-ANAPC7 Antibody

Product Images

WB Suggested Anti-ANAPC7 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-ANAPC7 Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: anaphase promoting complex subunit 7
• Database Link:
  NP_057322
  Entrez Gene 51434 Human
  UniProt ID Q9UJX3
• Background: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462). [supplied by OMIM]
• Synonyms: APC7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis