Antibodies for $/€ 289

Jump to Filters
View as table Download
NIP7 Rabbit Polyclonal Antibody
TA343841

USD 475.00

5 Days

Rabbit Polyclonal Anti-NIP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the middle region of human NIP7. Synthetic peptide located within the following region: PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST
NIP7 Rabbit Polyclonal Antibody
TA343842

USD 410.00

5 Days

Rabbit Polyclonal Anti-NIP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the C terminal of human NIP7. Synthetic peptide located within the following region: VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT