NIP7 Rabbit Polyclonal Antibody

CAT#: TA343842

Rabbit Polyclonal Anti-NIP7 Antibody

Product Images

WB Suggested Anti-NIP7 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate; NIP7 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-NIP7 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the C terminal of human NIP7. Synthetic peptide located within the following region: VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: NIP7, nucleolar pre-rRNA processing protein
• Database Link:
  NP_057185
  Entrez Gene 51388 Human
  UniProt ID Q9Y221
• Background: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
• Synonyms: CGI-37; HSPC031; KD93
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 79%; Zebrafish: 79%