Antibodies for $/€ 289

Jump to Filters
View as table Download
HNRNPA0 Rabbit Polyclonal Antibody
TA345987

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPA0 Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG