HNRNPA0 Rabbit Polyclonal Antibody

CAT#: TA345987

Rabbit Polyclonal Anti-HNRPA0 Antibody

Product Images

WB Suggested Anti-HNRPA0 Antibody Titration: 0.625 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Lanes: Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysate; Primary Antibody Dilution: 1: 4000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: HNRPA0;

• 

  Rabbit Anti-HNRPA0 Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-HNRPA0 Antibody; Paraffin Embedded Tissue: Human Liver; Cellular Data: Hepatocytes; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-HNRNPA0 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Sample Type: MCF7 cells; Primary Antibody Dilution: 1: 200; Secondary Antibody: Anti-rabbit-FITC; Secondary Antibody Dilution: 1: 500; Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green; Gene Name: HNRPA0;

• Amount and Sample Type: Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPA0 ppt. k562 sample; IP Antibody: HNRPA0; Amount of IP Antibody: Primary Antibody: HNRPA0; Primary Antibody Dilution: 1: 4000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: HNRPA0;

Show all 7 images

Specifications

Product Data

• Applications: IF, IHC, IP, WB
• Recommended Dilution: IF, IP, WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein A0
• Database Link:
  NP_006796
  Entrez Gene 10949 Human
  UniProt ID Q13151
• Background: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.
• Synonyms: HNRPA0
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%