Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit polyclonal HNRPA0 (Ab-84) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human HNRPA0. |
HNRNPA0 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HNRNPA0 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
HNRNPA0 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
HNRNPA0 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HNRNPA0 (NP_006796.1). |
| Modifications | Unmodified |
HNRNPA0 mouse monoclonal antibody,clone OTI8H8
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
