Rabbit Polyclonal Anti-TMPRSS3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS3 antibody: synthetic peptide directed towards the N terminal of human TMPRSS3. Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP |
Rabbit Polyclonal Anti-APEH Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APEH antibody: synthetic peptide directed towards the N terminal of human APEH. Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR |
Rabbit Polyclonal Anti-Rnpep Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rnpep antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnpep. Synthetic peptide located within the following region: TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD |
Rabbit Polyclonal Anti-Masp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT |
Germany
Japan
United Kingdom
China
