MASP2 Rabbit Polyclonal Antibody

CAT#: TA346117

Rabbit Polyclonal Anti-Masp2 Antibody

Product Images

WB Suggested Anti-Masp2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: mannan binding lectin serine peptidase 2
• Database Link:
  NP_006601
  Entrez Gene 17175 MouseEntrez Gene 10747 Human
  UniProt ID O00187
• Background: Masp2 is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase.
• Synonyms: MAP19; MASP-2; MASP1P1; sMAP
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 92%; Guinea pig: 79%; Horse: 77%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Complement and coagulation cascades