Antibodies for $/€ 289

Jump to Filters
View as table Download
ZBTB9 Rabbit Polyclonal Antibody
TA345562

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZBTB9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the N terminal of human ZBTB9. Synthetic peptide located within the following region: METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV
ZBTB9 Rabbit Polyclonal Antibody
TA345563

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZBTB9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the C terminal of human ZBTB9. Synthetic peptide located within the following region: HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK