ZBTB9 Rabbit Polyclonal Antibody

CAT#: TA345563

Rabbit Polyclonal Anti-ZBTB9 Antibody

Product Images

WB Suggested Anti-ZBTB9 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the C terminal of human ZBTB9. Synthetic peptide located within the following region: HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger and BTB domain containing 9
• Database Link:
  NP_689948
  Entrez Gene 221504 Human
  UniProt ID Q96C00
• Background: ZBTB9 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
• Synonyms: ZNF919
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors