Rabbit Polyclonal Anti-ZBTB9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the N terminal of human ZBTB9. Synthetic peptide located within the following region: METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV |
Rabbit Polyclonal Anti-ZBTB9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the C terminal of human ZBTB9. Synthetic peptide located within the following region: HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK |
Zbtb9 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
