Rabbit Polyclonal Anti-GTF3C5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF3C5 antibody: synthetic peptide directed towards the C terminal of human GTF3C5. Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE |
Rabbit Polyclonal Anti-Gtf3c5 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gtf3c5 antibody is: synthetic peptide directed towards the middle region of Rat Gtf3c5. Synthetic peptide located within the following region: IRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLP |
Germany
Japan
United Kingdom
China
