Antibodies for $/€ 289

Jump to Filters
View as table Download
Glutathione Peroxidase 4 (GPX4) Rabbit Polyclonal Antibody
TA344322

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX4 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA