Antibodies for $/€ 289

Jump to Filters
View as table Download
AMPK alpha 2 (PRKAA2) Rabbit Polyclonal Antibody
TA345140

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
DDIT4 Rabbit Polyclonal Antibody
TA344821

USD 475.00

5 Days

Rabbit Polyclonal Anti-DDIT4 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ddit4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ddit4. Synthetic peptide located within the following region: SLESSDCESLDSSNSGFGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLM