AMPK alpha 2 (PRKAA2) Rabbit Polyclonal Antibody

CAT#: TA345140

Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region

Product Images

WB Suggested Anti-PRKAA2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

• 

  Sample Type:???rat hepatocyte (50ug); Priamry Dilution:???1:4000; Secondary Antibody:???Donkey anti-Rabbit HRP; Secondary Dilution:???1:10,000; Image Submitted By:???Dustin Singer, ; INRA/AgroParistech???

• 

  PRKAA2 antibody - middle region validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: protein kinase AMP-activated catalytic subunit alpha 2
• Database Link:
  NP_006243
  Entrez Gene 78975 RatEntrez Gene 108079 MouseEntrez Gene 5563 Human
  UniProt ID P54646
• Background: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. Studies of the mouse counterpart suggest that this catalytic subunit may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia. [provided by RefSeq, Jul 2008]
• Synonyms: AMPK; AMPK2; AMPKa2; PRKAA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway, mTOR signaling pathway, Regulation of autophagy