Rabbit Polyclonal Anti-BCAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAS2 antibody: synthetic peptide directed towards the middle region of human BCAS2. Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
Rabbit Polyclonal Anti-BCAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAS2 antibody: synthetic peptide directed towards the N terminal of human BCAS2. Synthetic peptide located within the following region: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL |
Germany
Japan
United Kingdom
China