BCAS2 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2)
USD 823.00
Transient overexpression lysate of breast carcinoma amplified sequence 2 (BCAS2)
USD 396.00
Other products for "BCAS2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BCAS2 antibody: synthetic peptide directed towards the middle region of human BCAS2. Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | breast carcinoma amplified sequence 2 |
Database Link | |
Background | BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function. |
Synonyms | DAM1; Snt309; SPF27 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86% |
Reference Data | |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.