Antibodies for $/€ 289

Jump to Filters
View as table Download
TRPC3 Rabbit Polyclonal Antibody
TA344232

USD 475.00

5 Days

Rabbit Polyclonal Anti-TRPC3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3. Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG
TRPC6 Rabbit Polyclonal Antibody
TA344231

USD 475.00

5 Days

Rabbit Polyclonal Anti-TRPC6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC