TRPC3 Rabbit Polyclonal Antibody

CAT#: TA344232

Rabbit Polyclonal Anti-TRPC3 Antibody - N-terminal region

Product Images

WB Suggested Anti-TRPC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  TRPC3 antibody - N-terminal region validated by WB using brainstem, Cerebellum, Thalamus, Hipppcampus, Cerebral Cortex

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3. Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: transient receptor potential cation channel subfamily C member 3
• Database Link:
  NP_003296
  Entrez Gene 22065 MouseEntrez Gene 7222 Human
  UniProt ID Q13507
• Background: TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.
• Synonyms: SCA41; TRP3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane