Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-EVI1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Rabbit Polyclonal Anti-EVI1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Rabbit Polyclonal Anti-EVI1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the N terminal of human EVI1. Synthetic peptide located within the following region: VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP

Rabbit Polyclonal Anti-SHC3 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Shc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS