EVI1 (MECOM) Rabbit Polyclonal Antibody

CAT#: TA344283

Rabbit Polyclonal Anti-EVI1 Antibody - middle region

Product Images

WB Suggested Anti-EVI1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: MDS1 and EVI1 complex locus
• Database Link:
  NP_005232
  Entrez Gene 2122 Human
  UniProt ID Q03112
• Background: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
• Synonyms: AML1-EVI-1; EVI1; MDS1; MDS1-EVI1; PRDM3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Chronic myeloid leukemia, MAPK signaling pathway, Pathways in cancer