Rabbit Polyclonal Anti-MDS032 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
Rabbit Polyclonal Anti-C1orf142 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL |
Rabbit Polyclonal Anti-SNAP23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC |
Germany
Japan
United Kingdom
China
