Antibodies for $/€ 289

Jump to Filters
View as table Download
KAT7 Rabbit Polyclonal Antibody
TA343654

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: PRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQ