Rabbit Polyclonal Anti-ACTR3B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTR3B antibody: synthetic peptide directed towards the N terminal of human ACTR3B. Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR |
Rabbit Polyclonal Anti-ACTR3B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTR3B antibody: synthetic peptide directed towards the N terminal of human ACTR3B. Synthetic peptide located within the following region: MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR |
Germany
Japan
United Kingdom
China