Rabbit Polyclonal Anti-BCL7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN |
Rabbit Polyclonal Anti-BCL7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: QENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQS |
Germany
Japan
United Kingdom
China
